Lineage for d2gnnd_ (2gnn D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3034009Species Orf virus [TaxId:10259] [255191] (1 PDB entry)
  8. 3034013Domain d2gnnd_: 2gnn D: [241940]
    automated match to d1wq8a_
    complexed with ben, cl, gol, nag, so4, trs

Details for d2gnnd_

PDB Entry: 2gnn (more details), 2.3 Å

PDB Description: crystal structure of the orf virus nz2 variant of vegf-e
PDB Compounds: (D:) Vascular endothelial growth factor homolog

SCOPe Domain Sequences for d2gnnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnnd_ g.17.1.0 (D:) automated matches {Orf virus [TaxId: 10259]}
tkgwsevlkgseckprpivvpvsethpeltsqrfnppcvtlmrcggccndeslecvptee
vnvtmellgasgsgsngmqrlsfvehkkcdcrp

SCOPe Domain Coordinates for d2gnnd_:

Click to download the PDB-style file with coordinates for d2gnnd_.
(The format of our PDB-style files is described here.)

Timeline for d2gnnd_: