SCOPe 2.05: Domain d2g4aa_: 2g4a A:

Lineage for d2g4aa_ (2g4a A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d2g4aa_: 2g4a A: [241902]
   automated match to d4j1pa_

Details for d2g4aa_

PDB Entry: 2g4a

PDB Description: solution structure of a bromodomain from ring3 protein

PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2g4aa_:

Sequence; same for both SEQRES and ATOM records:

>d2g4aa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqlkhcnvilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmenrd
yrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

Timeline for d2g4aa_:

• d2g4aa_ first appeared in SCOPe 2.04
  
• d2g4aa_ appears in SCOPe 2.06
  
• d2g4aa_ appears in the current release, SCOPe 2.08