SCOPe 2.06: Domain d2g0fa_: 2g0f A:

Lineage for d2g0fa_ (2g0f A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187437] (4 PDB entries)

8. Domain d2g0fa_: 2g0f A: [241887]
   automated match to d1z5ye1
   mutant

Details for d2g0fa_

PDB Entry: 2g0f, 2.2 Å

PDB Description: crystal structure of p144a mutant of e.coli ccmg protein

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbE

SCOPe Domain Sequences for d2g0fa_:

Sequence; same for both SEQRES and ATOM records:

>d2g0fa_ c.47.1.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
lesaligkpvpkfrlesldnpgqfyqadvltqgkpvllnvwatwcptcraehqylnqlsa
qgirvvgmnykddrqkaiswlkelgnpyalslfdgdgmlgldlgvygaaetflidgngii
ryrhagdlnprvweeeikplwekyskeaa

Timeline for d2g0fa_:

• d2g0fa_ first appeared in SCOPe 2.04
  
• d2g0fa_ appears in SCOPe 2.05
  
• d2g0fa_ appears in SCOPe 2.07
  
• d2g0fa_ appears in the current release, SCOPe 2.08