SCOPe 2.07: Domain d2feba1: 2feb A:7-102

Lineage for d2feba1 (2feb A:7-102)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein automated matches [226950] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)

8. Domain d2feba1: 2feb A:7-102 [241831]
   Other proteins in same PDB: d2feba2
   automated match to d1jfna_

Details for d2feba1

PDB Entry: 2feb

PDB Description: nmr solution structure, dynamics and binding properties of the kringle iv type 8 module of apolipoprotein(a)

PDB Compounds: (A:) apolipoprotein(a)

SCOPe Domain Sequences for d2feba1:

Sequence; same for both SEQRES and ATOM records:

>d2feba1 g.14.1.1 (A:7-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aptenstgvqdcyrgdgqsyrgtlsttitgrtcqswssmtphwhrriplyypnagltrny
crnpdaeirpwcytmdpsvrweycnltrcpvtessv

Timeline for d2feba1:

• d2feba1 first appeared in SCOPe 2.04, called d2feba_
  
• d2feba1 appears in SCOPe 2.06
  
• d2feba1 appears in the current release, SCOPe 2.08