PDB entry 2feb

View 2feb on RCSB PDB site
Description: NMR Solution Structure, Dynamics and Binding Properties of the Kringle IV Type 8 module of apolipoprotein(a)
Class: hydrolase
Keywords: tri-loop structure, disulphide bonded protein, HYDROLASE
Deposited on 2005-12-15, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein(a)
    Species: Homo sapiens [TaxId:9606]
    Gene: LPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08519 (6-101)
      • cloning artifact (0-5)
    Domains in SCOPe 2.07: d2feba1, d2feba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2febA (A:)
    iegrhmaptenstgvqdcyrgdgqsyrgtlsttitgrtcqswssmtphwhrriplyypna
    gltrnycrnpdaeirpwcytmdpsvrweycnltrcpvtessv