SCOPe 2.06: Domain d2do4a1: 2do4 A:791-877

Lineage for d2do4a1 (2do4 A:791-877)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d2do4a1: 2do4 A:791-877 [241636]
   Other proteins in same PDB: d2do4a2, d2do4a3
   automated match to d1x4aa1

Details for d2do4a1

PDB Entry: 2do4

PDB Description: solution structure of the rna binding domain of squamous cell carcinoma antigen recognized by t cells 3

PDB Compounds: (A:) Squamous cell carcinoma antigen recognized by T-cells 3

SCOPe Domain Sequences for d2do4a1:

Sequence; same for both SEQRES and ATOM records:

>d2do4a1 d.58.7.0 (A:791-877) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vfrystslekhklfisglpfsctkeeleeickahgtvkdlrlvtnragkpkglayveyen
esqasqavmkmdgmtikeniikvaisn

Timeline for d2do4a1:

• d2do4a1 first appeared in SCOPe 2.04, called d2do4a_
  
• d2do4a1 was called d2do4a_ in SCOPe 2.05
  
• d2do4a1 appears in SCOPe 2.07
  
• d2do4a1 appears in the current release, SCOPe 2.08