Lineage for d2dk9a1 (2dk9 A:1-109)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325260Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2325261Protein automated matches [226856] (4 species)
    not a true protein
  7. 2325267Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2325339Domain d2dk9a1: 2dk9 A:1-109 [241581]
    Other proteins in same PDB: d2dk9a2
    automated match to d1bkra_

Details for d2dk9a1

PDB Entry: 2dk9 (more details)

PDB Description: solution structure of calponin homology domain of human mical-1
PDB Compounds: (A:) nedd9-interacting protein with calponin homology and lim domains

SCOPe Domain Sequences for d2dk9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dk9a1 a.40.1.0 (A:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsagtqeellrwcqeqtagypgvhvsdlssswadglalcalvyrlqpgllepselqglga
leatawalkvaenelgitpvvsaqavvagsdplgliaylshfhsafksm

SCOPe Domain Coordinates for d2dk9a1:

Click to download the PDB-style file with coordinates for d2dk9a1.
(The format of our PDB-style files is described here.)

Timeline for d2dk9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dk9a2