Class a: All alpha proteins [46456] (286 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.0: automated matches [254220] (1 protein) not a true family |
Protein automated matches [254501] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255112] (2 PDB entries) |
Domain d2daga_: 2dag A: [241537] automated match to d1whca_ |
PDB Entry: 2dag (more details)
SCOPe Domain Sequences for d2daga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2daga_ a.5.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgldesviiqlvemgfpmdacrkavyytgnsgaeaamnwvmshmddpdfanplil pgssgpgssgpssg
Timeline for d2daga_: