Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [255080] (2 PDB entries) |
Domain d2c2ua_: 2c2u A: [241406] automated match to d3ak8f_ complexed with fe, so4, zn |
PDB Entry: 2c2u (more details), 1.1 Å
SCOPe Domain Sequences for d2c2ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2ua_ a.25.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]} ggadhadaahlgtvnnalvnhhyleekefqtvaetlqrnlattislylkfkkyhwdirgr ffrdlhlaydefiaeifpsideqaerlvalggsplaapadlarystvqvpqetvrdartq vadlvqdlsrvgkgyrddsqacdeandpvtadmyngyaatidkirwmlqaimdderld
Timeline for d2c2ua_: