Lineage for d2byri1 (2byr I:1-208)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2085014Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2085015Protein automated matches [193506] (6 species)
    not a true protein
  7. 2085046Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2085210Domain d2byri1: 2byr I:1-208 [241374]
    Other proteins in same PDB: d2byra2, d2byrb2, d2byrc2, d2byrd2, d2byre2, d2byrf2, d2byri2, d2byrj2
    automated match to d2c9ta_
    complexed with mlk

Details for d2byri1

PDB Entry: 2byr (more details), 2.45 Å

PDB Description: crystal structure of achbp from aplysia californica in complex with methyllycaconitine
PDB Compounds: (I:) acetylcholine-binding protein

SCOPe Domain Sequences for d2byri1:

Sequence, based on SEQRES records: (download)

>d2byri1 b.96.1.0 (I:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records): (download)

>d2byri1 b.96.1.0 (I:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d2byri1:

Click to download the PDB-style file with coordinates for d2byri1.
(The format of our PDB-style files is described here.)

Timeline for d2byri1: