Lineage for d2azva_ (2azv A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536478Protein automated matches [190043] (6 species)
    not a true protein
  7. 1536498Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255023] (4 PDB entries)
  8. 1536500Domain d2azva_: 2azv A: [241245]
    automated match to d1gbra_
    mutant

Details for d2azva_

PDB Entry: 2azv (more details)

PDB Description: solution structure of the t22g mutant of n-terminal sh3 domain of drk (calculated without noes)
PDB Compounds: (A:) SH2-SH3 adapter protein drk

SCOPe Domain Sequences for d2azva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azva_ b.34.2.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
meaiakhdfsataddelsfrkgqilkilnmeddsnwyraeldgkeglipsnyiemknhd

SCOPe Domain Coordinates for d2azva_:

Click to download the PDB-style file with coordinates for d2azva_.
(The format of our PDB-style files is described here.)

Timeline for d2azva_: