PDB entry 2azv

View 2azv on RCSB PDB site
Description: Solution structure of the T22G mutant of N-terminal SH3 domain of DRK (calculated without NOEs)
Class: signaling protein
Keywords: beta-barrel, SIGNALING PROTEIN
Deposited on 2005-09-12, released 2005-12-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SH2-SH3 adapter protein drk
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: drk, E sev 2B
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08012 (0-58)
    • engineered (21)
  Domains in SCOPe 2.04: d2azva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2azvA (A:)
  meaiakhdfsataddelsfrkgqilkilnmeddsnwyraeldgkeglipsnyiemknhd