Lineage for d4no9f_ (4no9 F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1679108Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1679109Protein automated matches [190509] (9 species)
    not a true protein
  7. 1679150Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (9 PDB entries)
  8. 1679164Domain d4no9f_: 4no9 F: [240646]
    Other proteins in same PDB: d4no9a_, d4no9b_, d4no9c_, d4no9d_, d4no9e_, d4no9g_, d4no9h_, d4no9i_, d4no9j_, d4no9k_, d4no9l_, d4no9m_, d4no9n_, d4no9o_, d4no9p_, d4no9q_, d4no9r_, d4no9s_, d4no9u_, d4no9v_, d4no9w_, d4no9x_, d4no9y_, d4no9z_
    automated match to d1irug_
    complexed with 2l0, 2lr, mg

Details for d4no9f_

PDB Entry: 4no9 (more details), 2.9 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-epoxyketone
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4no9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no9f_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4no9f_:

Click to download the PDB-style file with coordinates for d4no9f_.
(The format of our PDB-style files is described here.)

Timeline for d4no9f_: