Lineage for d4lptc1 (4lpt C:1-95)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2372249Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2372250Protein automated matches [190976] (5 species)
    not a true protein
  7. 2372251Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)
  8. 2372259Domain d4lptc1: 4lpt C:1-95 [240496]
    Other proteins in same PDB: d4lpta2, d4lptb2, d4lptc2, d4lptd2, d4lpte2
    automated match to d4lpta_

Details for d4lptc1

PDB Entry: 4lpt (more details), 2.54 Å

PDB Description: Crystal structure of monomeric TENCON variant P54CR4-31
PDB Compounds: (C:) TENCON variant P54CR4-31

SCOPe Domain Sequences for d4lptc1:

Sequence, based on SEQRES records: (download)

>d4lptc1 b.1.2.0 (C:1-95) automated matches {Artificial gene [TaxId: 32630]}
mlpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlgsyvfehdvmlplsaeftt

Sequence, based on observed residues (ATOM records): (download)

>d4lptc1 b.1.2.0 (C:1-95) automated matches {Artificial gene [TaxId: 32630]}
mlpapknlvvsevtedslrlswtapdaafdsfliqyqesegeainltvpgsersydltgl
kpgteytvsiygvlgsyvfehdvmlplsaeftt

SCOPe Domain Coordinates for d4lptc1:

Click to download the PDB-style file with coordinates for d4lptc1.
(The format of our PDB-style files is described here.)

Timeline for d4lptc1: