SCOPe 2.07: Domain d4kntb1: 4knt B:25-153

Lineage for d4kntb1 (4knt B:25-153)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries)

8. Domain d4kntb1: 4knt B:25-153 [240432]
   automated match to d4kntc1
   complexed with cu, gol

Details for d4kntb1

PDB Entry: 4knt, 1.9 Å

PDB Description: Copper nitrite reductase from Nitrosomonas europaea pH 8.5

PDB Compounds: (B:) Multicopper oxidase type 1

SCOPe Domain Sequences for d4kntb1:

Sequence; same for both SEQRES and ATOM records:

>d4kntb1 b.6.1.0 (B:25-153) automated matches {Nitrosomonas europaea [TaxId: 228410]}
ktvqvtlhavetdvaydnkgstyrawtfdgkvpgpvvrvtegdtveftlindknsknshs
mdfhaarldvvedfesikpgetkkytftadnpgvffyhcgsdpmiqhiargmygviivdp
kdanalpka

Timeline for d4kntb1:

• d4kntb1 first appeared in SCOPe 2.04
  
• d4kntb1 appears in SCOPe 2.06
  
• d4kntb1 appears in the current release, SCOPe 2.08