Lineage for d4knta1 (4knt A:25-153)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382278Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries)
  8. 2382291Domain d4knta1: 4knt A:25-153 [240430]
    automated match to d4kntc1
    complexed with cu, gol

Details for d4knta1

PDB Entry: 4knt (more details), 1.9 Å

PDB Description: Copper nitrite reductase from Nitrosomonas europaea pH 8.5
PDB Compounds: (A:) Multicopper oxidase type 1

SCOPe Domain Sequences for d4knta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4knta1 b.6.1.0 (A:25-153) automated matches {Nitrosomonas europaea [TaxId: 228410]}
ktvqvtlhavetdvaydnkgstyrawtfdgkvpgpvvrvtegdtveftlindknsknshs
mdfhaarldvvedfesikpgetkkytftadnpgvffyhcgsdpmiqhiargmygviivdp
kdanalpka

SCOPe Domain Coordinates for d4knta1:

Click to download the PDB-style file with coordinates for d4knta1.
(The format of our PDB-style files is described here.)

Timeline for d4knta1: