Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [256301] (1 PDB entry) |
Domain d4iiqc2: 4iiq C:115-291 [240236] Other proteins in same PDB: d4iiqa1, d4iiqa2, d4iiqb1, d4iiqb2, d4iiqc1, d4iiqc3 automated match to d2xfxa1 complexed with so4 |
PDB Entry: 4iiq (more details), 2.86 Å
SCOPe Domain Sequences for d4iiqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iiqc2 d.19.1.0 (C:115-291) automated matches {Cow (Bos taurus) [TaxId: 9913]} thslryfrlgisepgygipefisagyvdshpitmynsvsqlxepralwmeenlapdhwer ytqllrgwqqafkvelkqlqhhynhsgfhtyqrmigcelledgsitgflqyaydgqdfli fnkdtlswmamdnvadiirrvweanrhelqyqknwleeeciawlkrfleygkdalqr
Timeline for d4iiqc2:
View in 3D Domains from other chains: (mouse over for more information) d4iiqa1, d4iiqa2, d4iiqb1, d4iiqb2 |