Lineage for d4iiqc2 (4iiq C:115-291)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938671Species Cow (Bos taurus) [TaxId:9913] [256301] (1 PDB entry)
  8. 2938672Domain d4iiqc2: 4iiq C:115-291 [240236]
    Other proteins in same PDB: d4iiqa1, d4iiqa2, d4iiqb1, d4iiqb2, d4iiqc1, d4iiqc3
    automated match to d2xfxa1
    complexed with so4

Details for d4iiqc2

PDB Entry: 4iiq (more details), 2.86 Å

PDB Description: crystal structure of a human mait tcr in complex with bovine mr1
PDB Compounds: (C:) Beta-2-microglobulin, MHC class I-related protein

SCOPe Domain Sequences for d4iiqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iiqc2 d.19.1.0 (C:115-291) automated matches {Cow (Bos taurus) [TaxId: 9913]}
thslryfrlgisepgygipefisagyvdshpitmynsvsqlxepralwmeenlapdhwer
ytqllrgwqqafkvelkqlqhhynhsgfhtyqrmigcelledgsitgflqyaydgqdfli
fnkdtlswmamdnvadiirrvweanrhelqyqknwleeeciawlkrfleygkdalqr

SCOPe Domain Coordinates for d4iiqc2:

Click to download the PDB-style file with coordinates for d4iiqc2.
(The format of our PDB-style files is described here.)

Timeline for d4iiqc2: