SCOPe 2.06: Domain d1cn1b_: 1cn1 B:

Lineage for d1cn1b_ (1cn1 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (4 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (59 PDB entries)
   Uniprot P81461

8. Domain d1cn1b_: 1cn1 B: [24019]

Details for d1cn1b_

PDB Entry: 1cn1, 3.2 Å

PDB Description: crystal structure of demetallized concanavalin a. the metal-binding region

PDB Compounds: (B:) concanavalin a

SCOPe Domain Sequences for d1cn1b_:

Sequence; same for both SEQRES and ATOM records:

>d1cn1b_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqdgkvgtahiiynsvdkr
lsavvsypnadatsvsydvdlndvlpewvrvglsastglyketntilswsftsklksnst
hqtdalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspegssvgralfyapvh
iwessaatvsfeatfaflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1cn1b_:

• d1cn1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cn1b_ appears in SCOPe 2.05
  
• d1cn1b_ appears in SCOPe 2.07
  
• d1cn1b_ appears in the current release, SCOPe 2.08