SCOPe 2.06: Domain d4b5cc_: 4b5c C:

Lineage for d4b5cc_ (4b5c C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (11 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:28450] [234123] (1 PDB entry)

8. Domain d4b5cc_: 4b5c C: [240005]
   automated match to d4b5ca_
   complexed with act

Details for d4b5cc_

PDB Entry: 4b5c, 2.3 Å

PDB Description: crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei

PDB Compounds: (C:) putative ompa family lipoprotein

SCOPe Domain Sequences for d4b5cc_:

Sequence; same for both SEQRES and ATOM records:

>d4b5cc_ d.79.7.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
dplndpnsplakrsvyfdfdsysvqdqyqallqqhaqylkshpqrhiliqgntdergtse
ynlalgqkraeavrralsllgvgdaqmeavslgkekpvalghdeaswaqnrradlvyq

Timeline for d4b5cc_:

• d4b5cc_ first appeared in SCOPe 2.04
  
• d4b5cc_ appears in SCOPe 2.05
  
• d4b5cc_ appears in SCOPe 2.07
  
• d4b5cc_ appears in the current release, SCOPe 2.08