Lineage for d3uxld2 (3uxl D:133-359)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445529Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2445723Protein automated matches [226997] (13 species)
    not a true protein
  7. 2445801Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries)
  8. 2445814Domain d3uxld2: 3uxl D:133-359 [239883]
    Other proteins in same PDB: d3uxla1, d3uxlb1, d3uxlc1, d3uxld1
    automated match to d3uxkd2
    complexed with cfi, mg

Details for d3uxld2

PDB Entry: 3uxl (more details), 2.2 Å

PDB Description: P. putida mandelate racemase co-crystallized with the intermediate analogue cupferron
PDB Compounds: (D:) mandelate racemase

SCOPe Domain Sequences for d3uxld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxld2 c.1.11.2 (D:133-359) automated matches {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOPe Domain Coordinates for d3uxld2:

Click to download the PDB-style file with coordinates for d3uxld2.
(The format of our PDB-style files is described here.)

Timeline for d3uxld2: