Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [228629] (7 PDB entries) |
Domain d3uxld1: 3uxl D:3-132 [239882] Other proteins in same PDB: d3uxlc2, d3uxld2 automated match to d3uxkd1 complexed with cfi, mg |
PDB Entry: 3uxl (more details), 2.2 Å
SCOPe Domain Sequences for d3uxld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uxld1 d.54.1.0 (D:3-132) automated matches {Pseudomonas putida [TaxId: 303]} evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp lvkllganar
Timeline for d3uxld1:
View in 3D Domains from other chains: (mouse over for more information) d3uxla1, d3uxlb1, d3uxlc1, d3uxlc2 |