Lineage for d3uqyt_ (3uqy T:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953691Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1953692Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1953832Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 1953833Protein automated matches [191172] (5 species)
    not a true protein
  7. 1953846Species Escherichia coli [TaxId:562] [256126] (5 PDB entries)
  8. 1953850Domain d3uqyt_: 3uqy T: [239874]
    Other proteins in same PDB: d3uqyl_, d3uqym_
    automated match to d3ayxb_
    complexed with cl, f3s, f4s, fco, gol, lmt, mg, ni, sf4, so4

Details for d3uqyt_

PDB Entry: 3uqy (more details), 1.47 Å

PDB Description: H2-reduced structure of E. coli hydrogenase-1
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d3uqyt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uqyt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrvv

SCOPe Domain Coordinates for d3uqyt_:

Click to download the PDB-style file with coordinates for d3uqyt_.
(The format of our PDB-style files is described here.)

Timeline for d3uqyt_: