Lineage for d3rtjb1 (3rtj B:1-135)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2062118Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2062119Protein automated matches [226913] (9 species)
    not a true protein
  7. 2062120Species Castor bean (Ricinus communis) [TaxId:3988] [256065] (1 PDB entry)
  8. 2062121Domain d3rtjb1: 3rtj B:1-135 [239703]
    Other proteins in same PDB: d3rtja_
    automated match to d1hwob1
    protein/RNA complex

Details for d3rtjb1

PDB Entry: 3rtj (more details), 3 Å

PDB Description: crystal structure of ricin bound with dinucleotide apg
PDB Compounds: (B:) Ricin B chain

SCOPe Domain Sequences for d3rtjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtjb1 b.42.2.0 (B:1-135) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
advcmdpepivrivgrnglcvdvrdgrfhngnaiqlwpcksntdanqlwtlkrdntirsn
gkclttygyspgvyvmiydcntaatdatrwqiwdngtiinprsslvlaatsgnsgttltv
qtniyavsqgwlptn

SCOPe Domain Coordinates for d3rtjb1:

Click to download the PDB-style file with coordinates for d3rtjb1.
(The format of our PDB-style files is described here.)

Timeline for d3rtjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rtjb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3rtja_