Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
Protein automated matches [226913] (9 species) not a true protein |
Species Castor bean (Ricinus communis) [TaxId:3988] [256065] (1 PDB entry) |
Domain d3rtjb1: 3rtj B:1-135 [239703] Other proteins in same PDB: d3rtja_ automated match to d1hwob1 protein/RNA complex |
PDB Entry: 3rtj (more details), 3 Å
SCOPe Domain Sequences for d3rtjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rtjb1 b.42.2.0 (B:1-135) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} advcmdpepivrivgrnglcvdvrdgrfhngnaiqlwpcksntdanqlwtlkrdntirsn gkclttygyspgvyvmiydcntaatdatrwqiwdngtiinprsslvlaatsgnsgttltv qtniyavsqgwlptn
Timeline for d3rtjb1: