Lineage for d3nvvj2 (3nvv J:93-165)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737421Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1737422Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1737423Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 1737501Protein automated matches [232101] (1 species)
    not a true protein
  7. 1737502Species Cow (Bos taurus) [TaxId:9913] [232106] (9 PDB entries)
  8. 1737506Domain d3nvvj2: 3nvv J:93-165 [239512]
    Other proteins in same PDB: d3nvva1, d3nvvb1, d3nvvb2, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvk1, d3nvvk2, d3nvvl1, d3nvvl2
    automated match to d3etrl2
    complexed with ast, fad, fes, mos, mte

Details for d3nvvj2

PDB Entry: 3nvv (more details), 1.82 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (J:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvvj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvvj2 a.56.1.1 (J:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3nvvj2:

Click to download the PDB-style file with coordinates for d3nvvj2.
(The format of our PDB-style files is described here.)

Timeline for d3nvvj2: