SCOPe 2.05: Domain d3m5gb_: 3m5g B:

Lineage for d3m5gb_ (3m5g B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)

8. Domain d3m5gb_: 3m5g B: [239447]
   Other proteins in same PDB: d3m5ga_, d3m5gc_, d3m5ge_
   automated match to d4n5zb_
   complexed with nag, peg

Details for d3m5gb_

PDB Entry: 3m5g, 2.6 Å

PDB Description: crystal structure of a h7 influenza virus hemagglutinin

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3m5gb_:

Sequence; same for both SEQRES and ATOM records:

>d3m5gb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqid

Timeline for d3m5gb_:

• d3m5gb_ first appeared in SCOPe 2.04
  
• d3m5gb_ appears in SCOPe 2.06
  
• d3m5gb_ appears in the current release, SCOPe 2.08