Lineage for d1scs__ (1scs -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164506Protein Concanavalin A [49901] (2 species)
  7. 164512Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (42 PDB entries)
  8. 164518Domain d1scs__: 1scs - [23930]

Details for d1scs__

PDB Entry: 1scs (more details), 1.6 Å

PDB Description: high-resolution structures of single-metal-substituted concanavalin a: the co,ca-protein at 1.6 angstroms and the ni,ca-protein at 2.0 angstroms

SCOP Domain Sequences for d1scs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scs__ b.29.1.1 (-) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1scs__:

Click to download the PDB-style file with coordinates for d1scs__.
(The format of our PDB-style files is described here.)

Timeline for d1scs__: