PDB entry 1scs

View 1scs on RCSB PDB site
Description: high-resolution structures of single-metal-substituted concanavalin a: the co,ca-protein at 1.6 angstroms and the ni,ca-protein at 2.0 angstroms
Deposited on 1993-12-06, released 1994-05-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1scs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1scs_ (-)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan