Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily) beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops |
Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) duplication: consists of 4 structural repeats arranged in 2 lobes contains one left-hand beta-alpha-beta unit per lobe automatically mapped to Pfam PF02738 |
Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins) |
Protein automated matches [230468] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232097] (9 PDB entries) |
Domain d3eubl2: 3eub L:695-1315 [239257] Other proteins in same PDB: d3eub21, d3eub22, d3eub31, d3eub32, d3eub41, d3euba1, d3euba2, d3eubb1, d3eubb2, d3eubc1, d3eubj1, d3eubj2, d3eubk1, d3eubk2, d3eubl1, d3eubs1, d3eubs2, d3eubt1, d3eubt2, d3eubu1 automated match to d3eub42 complexed with fad, fes, mom, mte, xan |
PDB Entry: 3eub (more details), 2.6 Å
SCOPe Domain Sequences for d3eubl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eubl2 d.133.1.1 (L:695-1315) automated matches {Cow (Bos taurus) [TaxId: 9913]} iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf rldspatpekirnacvdkftt
Timeline for d3eubl2: