Lineage for d3dvai_ (3dva I:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986630Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1986631Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 1986661Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 1986662Protein automated matches [191291] (5 species)
    not a true protein
  7. 1986663Species Bacillus stearothermophilus [TaxId:1422] [255802] (3 PDB entries)
  8. 1986664Domain d3dvai_: 3dva I: [239223]
    Other proteins in same PDB: d3dvaa_, d3dvab1, d3dvab2, d3dvac_, d3dvad1, d3dvad2, d3dvae_, d3dvaf1, d3dvaf2, d3dvag_, d3dvah1, d3dvah2
    automated match to d1w3da_
    complexed with k, mg, tpw

Details for d3dvai_

PDB Entry: 3dva (more details), 2.35 Å

PDB Description: snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (I:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d3dvai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvai_ a.9.1.0 (I:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
rviampsvrkyarekgvdirlvqgtgkngrvlkedidaflag

SCOPe Domain Coordinates for d3dvai_:

Click to download the PDB-style file with coordinates for d3dvai_.
(The format of our PDB-style files is described here.)

Timeline for d3dvai_: