Class b: All beta proteins [48724] (177 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) automatically mapped to Pfam PF00431 |
Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
Protein Major seminal plasma glycoprotein PSP-II [49860] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [49861] (1 PDB entry) |
Domain d1sppb_: 1spp B: [23897] Other proteins in same PDB: d1sppa_ |
PDB Entry: 1spp (more details), 2.4 Å
SCOPe Domain Sequences for d1sppb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} aringpdecgrvikdtsgsisntdrqknlctwtilmkpdqkvrmaipylnlacgkeyvev fdgllsgpsygklcagaaivflstantmtikynrisgnssspfliyfygssp
Timeline for d1sppb_: