Lineage for d1sppb_ (1spp B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049212Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2049213Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2049214Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2049235Protein Major seminal plasma glycoprotein PSP-II [49860] (1 species)
  7. 2049236Species Pig (Sus scrofa) [TaxId:9823] [49861] (1 PDB entry)
  8. 2049237Domain d1sppb_: 1spp B: [23897]
    Other proteins in same PDB: d1sppa_

Details for d1sppb_

PDB Entry: 1spp (more details), 2.4 Å

PDB Description: the crystal structures of two members of the spermadhesin family reveal the folding of the cub domain
PDB Compounds: (B:) major seminal plasma glycoprotein psp-II

SCOPe Domain Sequences for d1sppb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]}
aringpdecgrvikdtsgsisntdrqknlctwtilmkpdqkvrmaipylnlacgkeyvev
fdgllsgpsygklcagaaivflstantmtikynrisgnssspfliyfygssp

SCOPe Domain Coordinates for d1sppb_:

Click to download the PDB-style file with coordinates for d1sppb_.
(The format of our PDB-style files is described here.)

Timeline for d1sppb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sppa_