Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein automated matches [190627] (7 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries) |
Domain d2qreg2: 2qre G:182-316 [238837] Other proteins in same PDB: d2qrea_, d2qreb_, d2qrec_, d2qred_, d2qree3, d2qreg3 automated match to d2ooxe2 complexed with amz |
PDB Entry: 2qre (more details), 3.01 Å
SCOPe Domain Sequences for d2qreg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qreg2 d.37.1.1 (G:182-316) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle gilsladilnyiiyd
Timeline for d2qreg2: