Lineage for d2jj1b3 (2jj1 B:380-509)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330430Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2330431Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2330655Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2330656Protein automated matches [254528] (17 species)
    not a true protein
  7. 2330691Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)
  8. 2330708Domain d2jj1b3: 2jj1 B:380-509 [238727]
    Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1b1, d2jj1b2, d2jj1c1, d2jj1c2, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1i1, d2jj1i2, d2jj1j1, d2jj1j2, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_
    automated match to d1maba1
    complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1b3

PDB Entry: 2jj1 (more details), 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.
PDB Compounds: (B:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj1b3:

Sequence, based on SEQRES records: (download)

>d2jj1b3 a.69.1.0 (B:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfe

Sequence, based on observed residues (ATOM records): (download)

>d2jj1b3 a.69.1.0 (B:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklkeivtnflag
fe

SCOPe Domain Coordinates for d2jj1b3:

Click to download the PDB-style file with coordinates for d2jj1b3.
(The format of our PDB-style files is described here.)

Timeline for d2jj1b3: