Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries) |
Domain d2jj1h1: 2jj1 H:24-94 [238731] Other proteins in same PDB: d2jj1a2, d2jj1a3, d2jj1b2, d2jj1b3, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h2, d2jj1h3, d2jj1i2, d2jj1i3, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_ automated match to d1maba2 complexed with adp, anp, azi, gol, mg, pit, po4 |
PDB Entry: 2jj1 (more details), 2.7 Å
SCOPe Domain Sequences for d2jj1h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj1h1 b.49.1.0 (H:24-94) automated matches {Cow (Bos taurus) [TaxId: 9913]} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d2jj1h1:
View in 3D Domains from other chains: (mouse over for more information) d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_ |