Lineage for d2i5ja2 (2i5j A:430-552)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495132Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)
  8. 2495148Domain d2i5ja2: 2i5j A:430-552 [238682]
    Other proteins in same PDB: d2i5ja1, d2i5jb_
    automated match to d2ykna2
    protein/RNA complex; complexed with glc, k05, mg, suc

Details for d2i5ja2

PDB Entry: 2i5j (more details), 3.15 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with dhbnh, an rnase h inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H P66 subunit

SCOPe Domain Sequences for d2i5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5ja2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

SCOPe Domain Coordinates for d2i5ja2:

Click to download the PDB-style file with coordinates for d2i5ja2.
(The format of our PDB-style files is described here.)

Timeline for d2i5ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i5ja1
View in 3D
Domains from other chains:
(mouse over for more information)
d2i5jb_