Lineage for d2ykna2 (2ykn A:430-557)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495149Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries)
  8. 2495151Domain d2ykna2: 2ykn A:430-557 [207661]
    Other proteins in same PDB: d2ykna1, d2ykna3, d2yknb_
    automated match to d1bqna1
    complexed with ca, ykn

Details for d2ykna2

PDB Entry: 2ykn (more details), 2.12 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2ykna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ykna2 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

SCOPe Domain Coordinates for d2ykna2:

Click to download the PDB-style file with coordinates for d2ykna2.
(The format of our PDB-style files is described here.)

Timeline for d2ykna2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yknb_