Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mus musculus [TaxId:10090] [238130] (4 PDB entries) |
Domain d4ma1l2: 4ma1 L:108-214 [238444] Other proteins in same PDB: d4ma1l1 automated match to d1l7tl2 complexed with k, peg |
PDB Entry: 4ma1 (more details), 2.32 Å
SCOPe Domain Sequences for d4ma1l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ma1l2 b.1.1.2 (L:108-214) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d4ma1l2: