Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries) |
Domain d4k0ga1: 4k0g A:5-91 [238375] Other proteins in same PDB: d4k0ga2 automated match to d3o3ta1 complexed with act, ca; mutant |
PDB Entry: 4k0g (more details), 1.4 Å
SCOPe Domain Sequences for d4k0ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k0ga1 c.47.1.0 (A:5-91) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpqvelfvkagsdgakignspfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggql pfllygtevhtdtnkieefleavlcpp
Timeline for d4k0ga1: