Lineage for d4ppya_ (4ppy A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465640Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2465768Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2465769Protein automated matches [191059] (15 species)
    not a true protein
  7. 2465773Species Bacteroides fragilis [TaxId:272559] [238311] (1 PDB entry)
  8. 2465774Domain d4ppya_: 4ppy A: [238312]
    automated match to d4iyjb_

Details for d4ppya_

PDB Entry: 4ppy (more details), 2 Å

PDB Description: crystal structure of a putative acylhydrolase (bf3764) from bacteroides fragilis nctc 9343 at 2.00 a resolution
PDB Compounds: (A:) Putative acylhydrolase

SCOPe Domain Sequences for d4ppya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ppya_ c.23.10.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}
qekdwanlqryaqqnaelpkpdknekrvvfmgnsitegwvnthpdffksngyigrgiggq
tsyqflvrfredvinlspalvvinaatndiaentgayhedrtfgnivsmvelakanhikv
iltttlpaaafgwnpsikdapqkiaslnarlkayaqtnkipfvdyyssmvsgsnkalnpa
ytkdgvhptsegydvmenliqqainktlr

SCOPe Domain Coordinates for d4ppya_:

Click to download the PDB-style file with coordinates for d4ppya_.
(The format of our PDB-style files is described here.)

Timeline for d4ppya_: