Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
Protein automated matches [191059] (16 species) not a true protein |
Species Bacteroides fragilis [TaxId:272559] [238311] (1 PDB entry) |
Domain d4ppya_: 4ppy A: [238312] automated match to d4iyjb_ |
PDB Entry: 4ppy (more details), 2 Å
SCOPe Domain Sequences for d4ppya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ppya_ c.23.10.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]} qekdwanlqryaqqnaelpkpdknekrvvfmgnsitegwvnthpdffksngyigrgiggq tsyqflvrfredvinlspalvvinaatndiaentgayhedrtfgnivsmvelakanhikv iltttlpaaafgwnpsikdapqkiaslnarlkayaqtnkipfvdyyssmvsgsnkalnpa ytkdgvhptsegydvmenliqqainktlr
Timeline for d4ppya_: