SCOPe 2.06: Domain d4jz2a2: 4jz2 A:121-230

Lineage for d4jz2a2 (4jz2 A:121-230)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (31 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [226453] (4 PDB entries)

8. Domain d4jz2a2: 4jz2 A:121-230 [238156]
   Other proteins in same PDB: d4jz2a1
   automated match to d3tjta2
   complexed with co

Details for d4jz2a2

PDB Entry: 4jz2, 1.95 Å

PDB Description: Crystal structure of Co ion substituted SOD2 from Clostridium difficile

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4jz2a2:

Sequence; same for both SEQRES and ATOM records:

>d4jz2a2 d.44.1.0 (A:121-230) automated matches {Clostridium difficile [TaxId: 272563]}
ektipseslkeaidrdfgsfekfkqefqksaldvfgsgwawlvatkdgklsimttpnqds
pvsknltpiigldvwehayylkyqnrrneyidnwfnvvnwngalenyknl

Timeline for d4jz2a2:

• d4jz2a2 first appeared in SCOPe 2.03
  
• d4jz2a2 appears in SCOPe 2.05
  
• d4jz2a2 appears in SCOPe 2.07
  
• d4jz2a2 appears in the current release, SCOPe 2.08