Lineage for d4caeb1 (4cae B:27-210)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1427400Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1427401Protein automated matches [190038] (22 species)
    not a true protein
  7. 1427457Species Plasmodium vivax [TaxId:5855] [234134] (6 PDB entries)
  8. 1427459Domain d4caeb1: 4cae B:27-210 [238091]
    automated match to d1iica1
    complexed with 3f3, cl, dms, mg, nhw, so4

Details for d4caeb1

PDB Entry: 4cae (more details), 1.46 Å

PDB Description: Plasmodium vivax N-myristoyltransferase in complex with a benzothiophene inhibitor (compound 20b)
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4caeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4caeb1 d.108.1.0 (B:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d4caeb1:

Click to download the PDB-style file with coordinates for d4caeb1.
(The format of our PDB-style files is described here.)

Timeline for d4caeb1: