SCOPe 2.03: Domain d4caec1: 4cae C:27-210

Lineage for d4caec1 (4cae C:27-210)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (22 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [234134] (6 PDB entries)

8. Domain d4caec1: 4cae C:27-210 [238090]
   automated match to d1iica1
   complexed with 3f3, cl, dms, mg, nhw, so4

Details for d4caec1

PDB Entry: 4cae, 1.46 Å

PDB Description: Plasmodium vivax N-myristoyltransferase in complex with a benzothiophene inhibitor (compound 20b)

PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4caec1:

Sequence; same for both SEQRES and ATOM records:

>d4caec1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

Timeline for d4caec1:

• d4caec1 is new in SCOPe 2.03-stable
  
• d4caec1 appears in SCOPe 2.04
  
• d4caec1 appears in the current release, SCOPe 2.08