Lineage for d4ov2d_ (4ov2 D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490700Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1490701Protein automated matches [190513] (24 species)
    not a true protein
  7. 1490818Species Norway rat (Rattus norvegicus) [TaxId:10116] [238064] (1 PDB entry)
  8. 1490822Domain d4ov2d_: 4ov2 D: [238065]
    automated match to d1dgua_
    complexed with ca

Details for d4ov2d_

PDB Entry: 4ov2 (more details), 2.6 Å

PDB Description: Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus
PDB Compounds: (D:) neuronal calcium sensor 1

SCOPe Domain Sequences for d4ov2d_:

Sequence, based on SEQRES records: (download)

>d4ov2d_ a.39.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatf
vfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivda
iyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegs

Sequence, based on observed residues (ATOM records): (download)

>d4ov2d_ a.39.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lkpevveeltrktyftekevqqwykgfikdcpldaagfqkiykqffpfgdptkfatfvfn
vfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyq
mvgntvelpeeentpekrvdrifammdknadgkltlqefqegs

SCOPe Domain Coordinates for d4ov2d_:

Click to download the PDB-style file with coordinates for d4ov2d_.
(The format of our PDB-style files is described here.)

Timeline for d4ov2d_: