Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (10 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [238064] (1 PDB entry) |
Domain d4ov2d_: 4ov2 D: [238065] automated match to d1dgua_ complexed with ca |
PDB Entry: 4ov2 (more details), 2.6 Å
SCOPe Domain Sequences for d4ov2d_:
Sequence, based on SEQRES records: (download)
>d4ov2d_ a.39.1.0 (D:) automated matches {Rattus norvegicus [TaxId: 10116]} lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatf vfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivda iyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegs
>d4ov2d_ a.39.1.0 (D:) automated matches {Rattus norvegicus [TaxId: 10116]} lkpevveeltrktyftekevqqwykgfikdcpldaagfqkiykqffpfgdptkfatfvfn vfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyq mvgntvelpeeentpekrvdrifammdknadgkltlqefqegs
Timeline for d4ov2d_: