Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186847] (24 PDB entries) |
Domain d4o2ra_: 4o2r A: [238054] automated match to d4k81f_ complexed with gdp, mg; mutant |
PDB Entry: 4o2r (more details), 2.25 Å
SCOPe Domain Sequences for d4o2ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o2ra_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta vqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd lhmervisyeegkalaeswnaaflessakenqtavdvfkriileaek
Timeline for d4o2ra_: