Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins) this domain is inserted into a multihelical domain |
Protein BTV vp7, central (top) domain [49820] (1 species) |
Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries) |
Domain d1bvp32: 1bvp 3:121-254 [23777] Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61 |
PDB Entry: 1bvp (more details), 2.6 Å
SCOPe Domain Sequences for d1bvp32:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvp32 b.19.1.1 (3:121-254) BTV vp7, central (top) domain {Bluetongue virus [TaxId: 40051]} parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn amvqiqvvfyismd
Timeline for d1bvp32: