Lineage for d4mafc1 (4maf C:48-218)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1813773Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1813774Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1814030Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 1814031Protein automated matches [191089] (6 species)
    not a true protein
  7. 1814049Species Soybean (Glycine max) [TaxId:3847] [237646] (1 PDB entry)
  8. 1814052Domain d4mafc1: 4maf C:48-218 [237648]
    Other proteins in same PDB: d4mafa2, d4mafb2, d4mafc2, d4mafd2, d4mafe2, d4maff2, d4mafg2, d4mafh2
    automated match to d1g8fa1
    complexed with adx

Details for d4mafc1

PDB Entry: 4maf (more details), 2.48 Å

PDB Description: Soybean ATP Sulfurylase
PDB Compounds: (C:) ATP sulfurylase

SCOPe Domain Sequences for d4mafc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mafc1 b.122.1.0 (C:48-218) automated matches {Soybean (Glycine max) [TaxId: 3847]}
mliepdggklvelvvtdferdlkkgealslpriklsridlewvhvlsegwatplkgfmre
aeflqtlhfnslrlddgsvvnmsvpivlaiddaqkhrigdnkkvalfdskgdpvailnni
eiykhpkeeriartwgtiapglpyveqtitnagnwliggdleviepiqynd

SCOPe Domain Coordinates for d4mafc1:

Click to download the PDB-style file with coordinates for d4mafc1.
(The format of our PDB-style files is described here.)

Timeline for d4mafc1: