Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
Protein automated matches [191059] (10 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [236728] (5 PDB entries) |
Domain d4jj4a_: 4jj4 A: [237595] automated match to d1yzfa1 complexed with cl, gol; mutant |
PDB Entry: 4jj4 (more details), 2.13 Å
SCOPe Domain Sequences for d4jj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jj4a_ c.23.10.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} mkigsgekllfigdsitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl ktlypaalawarvhpsvaghmilaraflreigfewvrsr
Timeline for d4jj4a_: