SCOPe 2.03: Domain d4jj4a_: 4jj4 A:

Lineage for d4jj4a_ (4jj4 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (6 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [236728] (4 PDB entries)

8. Domain d4jj4a_: 4jj4 A: [237595]
   automated match to d1yzfa1
   complexed with cl, gol; mutant

Details for d4jj4a_

PDB Entry: 4jj4, 2.13 Å

PDB Description: crystal structure of a catalytic mutant of axe2 (axe2-d191a), an acetylxylan esterase from geobacillus stearothermophilus

PDB Compounds: (A:) acetyl xylan esterase

SCOPe Domain Sequences for d4jj4a_:

Sequence; same for both SEQRES and ATOM records:

>d4jj4a_ c.23.10.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdsitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalawarvhpsvaghmilaraflreigfewvrsr

Timeline for d4jj4a_:

• d4jj4a_ is new in SCOPe 2.03-stable
  
• d4jj4a_ appears in SCOPe 2.04
  
• d4jj4a_ appears in the current release, SCOPe 2.08