![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
![]() | Domain d1ghop3: 1gho P:3-219 [23757] Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo4, d1ghoo5, d1ghop1, d1ghop2, d1ghop4, d1ghop5 complexed with mg complexed with mg |
PDB Entry: 1gho (more details), 2.5 Å
SCOPe Domain Sequences for d1ghop3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghop3 b.18.1.5 (P:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1ghop3:
![]() Domains from same chain: (mouse over for more information) d1ghop1, d1ghop2, d1ghop4, d1ghop5 |
![]() Domains from other chains: (mouse over for more information) d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghoo5 |